PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr020642.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 297aa    MW: 33917.1 Da    PI: 7.4566
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr020642.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.31.2e-5281321128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeelv++yL++k++++++++  +i+e+d+yk++Pw+Lp  +  +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk++ +   +
  Pbr020642.1   8 LPPGFRFHPTDEELVKHYLCRKCASQPISV-PIIAEIDLYKYDPWELPGLALYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPIGH--PK 102
                  79****************************.88***************6555679*************************************99..78 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                   vg+kk Lvfy g+ap+gekt+W+mheyrl
  Pbr020642.1 103 PVGIKKALVFYAGKAPRGEKTNWIMHEYRL 132
                  9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.11E-635158IPR003441NAC domain
PROSITE profilePS5100560.9538158IPR003441NAC domain
PfamPF023653.9E-289132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MSSADLQLPP GFRFHPTDEE LVKHYLCRKC ASQPISVPII AEIDLYKYDP WELPGLALYG  60
EKEWYFFSPR DRKYPNGSRP NRAAGSGYWK ATGADKPIGH PKPVGIKKAL VFYAGKAPRG  120
EKTNWIMHEY RLADVDRSPR KKNSLRLDDW VLCRIYNKKG TVENQQPQQQ QEQQRTASRN  180
ASSGSEFEDR KPDNLRCPPP PASVVPSRHV SDYVYFDNSD SVPKLHTDSS CSEQVVSPEL  240
ACEVQSEPKW KEWEKALEIP YSYMDTTVEN GFGAQFQSGN EMSPLQDIFM YLQKPY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-8121639173Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009376875.10.0PREDICTED: NAC domain-containing protein 2
SwissprotQ390131e-149NAC2_ARATH; NAC domain-containing protein 2
TrEMBLD9ZJ920.0D9ZJ92_MALDO; NAC domain class transcription factor
STRINGPOPTR_0002s08150.11e-160(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125834108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-149NAC family protein